![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins) interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain |
![]() | Protein Beta-D-xylosidase [101926] (2 species) glycosyl hydrolase family 39 |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [141555] (3 PDB entries) Uniprot Q9ZFM2 5-14,362-503 |
![]() | Domain d2bfga1: 2bfg A:4-13,A:361-502 [128423] Other proteins in same PDB: d2bfga2, d2bfgb2, d2bfgc2, d2bfgd2, d2bfge2, d2bfgf2, d2bfgg2, d2bfgh2 complexed with anx, na, so4, xys |
PDB Entry: 2bfg (more details), 2.4 Å
SCOPe Domain Sequences for d2bfga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bfga1 b.71.1.2 (A:4-13,A:361-502) Beta-D-xylosidase {Bacillus stearothermophilus [TaxId: 1422]} vnvpsngrekXellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesav fikrqivneqygnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsiv lsknevtlieieqvrdetstyvglddgeitsys
Timeline for d2bfga1: