SCOP 1.73: Domain d2bfcb1: 2bfc B:2-204

Lineage for d2bfcb1 (2bfc B:2-204)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (4 proteins)
   parent family to TK and PFOR
   heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module

6. Protein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88743] (21 PDB entries)

8. Domain d2bfcb1: 2bfc B:2-204 [128417]
   Other proteins in same PDB: d2bfcb2
   automatically matched to d1olsb1
   complexed with gol, k, mn, tzd; mutant

Details for d2bfcb1

PDB Entry: 2bfc, 1.64 Å

PDB Description: reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch

PDB Compounds: (B:) 2-oxoisovalerate dehydrogenase beta subunit

SCOP Domain Sequences for d2bfcb1:

Sequence, based on SEQRES records:

>d2bfcb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
ahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglr
dkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrs
gdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscied
knpciffepkilyraaaeevpie

Sequence, based on observed residues (ATOM records):

>d2bfcb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
ahfeygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygkdrvf
ntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfncgsl
tirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpciffep
kilyraaaeevpie

Timeline for d2bfcb1:

• d2bfcb1 is new in SCOP 1.73
  
• d2bfcb1 appears in SCOP 1.75
  
• d2bfcb1 appears in the current release, SCOPe 2.08