Lineage for d2bfaa_ (2bfa A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. Protein Dihydropteridin reductase (pteridine reductase) [51769] (7 species)
  7. Species Leishmania major [TaxId:5664] [63926] (14 PDB entries)
    Uniprot Q01782
  8. Domain d2bfaa_: 2bfa A: [128413]
    automated match to d1e7wa_
    complexed with cb3, edo, ndp

Details for d2bfaa_

PDB Entry: 2bfa (more details), 2.7 Å

PDB Description: leishmania major pteridine reductase 1 in complex with nadp and cb3717
PDB Compounds: (A:) pteridine reductase 1

SCOPe Domain Sequences for d2bfaa_:

Sequence, based on SEQRES records: (download)

>d2bfaa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}
vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
lsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrndedg
hepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtn
qpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweghrskv
plyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra

Sequence, based on observed residues (ATOM records): (download)

>d2bfaa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}
vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
lsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrdreametatadl
fgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgaleg
ltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdvvif
lcsskakyitgtcvkvdggysltra

SCOPe Domain Coordinates for d2bfaa_ are not available.

Timeline for d2bfaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bfab_, d2bfac_, d2bfad_