SCOPe 2.04: Domain d2bf8b_: 2bf8 B:

Lineage for d2bf8b_ (2bf8 B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (41 PDB entries)

8. Domain d2bf8b_: 2bf8 B: [128412]
   Other proteins in same PDB: d2bf8a_
   automated match to d2ckhb1

Details for d2bf8b_

PDB Entry: 2bf8, 2.3 Å

PDB Description: crystal structure of sumo modified ubiquitin conjugating enzyme e2-25k

PDB Compounds: (B:) Ubiquitin-like protein SMT3C

SCOPe Domain Sequences for d2bf8b_:

Sequence; same for both SEQRES and ATOM records:

>d2bf8b_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkel
gmeeedvievyqeqtgg

Timeline for d2bf8b_:

• d2bf8b_ first appeared in SCOP 1.73, called d2bf8b1
  
• d2bf8b_ appears in SCOPe 2.03
  
• d2bf8b_ appears in SCOPe 2.05
  
• d2bf8b_ appears in the current release, SCOPe 2.08