SCOPe 2.01: Domain d2bf8b1: 2bf8 B:21-97

Lineage for d2bf8b1 (2bf8 B:21-97)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein SUMO-1 (smt3 homologue) [54241] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54242] (12 PDB entries)
   Uniprot Q93068

8. Domain d2bf8b1: 2bf8 B:21-97 [128412]
   Other proteins in same PDB: d2bf8a_
   automatically matched to d1tgzb_

Details for d2bf8b1

PDB Entry: 2bf8, 2.3 Å

PDB Description: crystal structure of sumo modified ubiquitin conjugating enzyme e2-25k

PDB Compounds: (B:) Ubiquitin-like protein SMT3C

SCOPe Domain Sequences for d2bf8b1:

Sequence; same for both SEQRES and ATOM records:

>d2bf8b1 d.15.1.1 (B:21-97) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
yiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkel
gmeeedvievyqeqtgg

Timeline for d2bf8b1:

• d2bf8b1 first appeared in SCOP 1.73
  
• d2bf8b1 appears in SCOP 1.75
  
• d2bf8b1 appears in SCOPe 2.02
  
• d2bf8b1 appears in the current release, SCOPe 2.08, called d2bf8b_