Lineage for d2bf8b1 (2bf8 B:21-97)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (8 families) 
Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
Pfam PF00240
Protein SUMO-1 (smt3 homologue) [54241] (2 species) Species Human (Homo sapiens) [TaxId:9606] [54242] (14 PDB entries)
Uniprot Q93068
Domain d2bf8b1: 2bf8 B:21-97 [128412]
Other proteins in same PDB: d2bf8a1
automatically matched to d1tgzb_
Details for d2bf8b1
PDB Entry: 2bf8 (more details), 2.3 Å
PDB Description: crystal structure of sumo modified ubiquitin conjugating enzyme e2-25k
PDB Compounds: (B:) Ubiquitin-like protein SMT3CSCOP Domain Sequences for d2bf8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bf8b1 d.15.1.1 (B:21-97) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
yiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkel
gmeeedvievyqeqtgg
SCOP Domain Coordinates for d2bf8b1:
Click to download the PDB-style file with coordinates for d2bf8b1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bf8b1:
- d2bf8b1 first appeared in SCOP 1.73
- d2bf8b1 appears in SCOPe 2.01
- d2bf8b1 appears in the current release, SCOPe 2.08, called d2bf8b_
View in 3D
