![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (8 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (38 proteins) Pfam PF00240 |
![]() | Protein SUMO-1 (smt3 homologue) [54241] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54242] (14 PDB entries) Uniprot Q93068 |
![]() | Domain d2bf8b1: 2bf8 B:21-97 [128412] Other proteins in same PDB: d2bf8a1 automatically matched to d1tgzb_ |
PDB Entry: 2bf8 (more details), 2.3 Å
SCOP Domain Sequences for d2bf8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bf8b1 d.15.1.1 (B:21-97) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} yiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkel gmeeedvievyqeqtgg
Timeline for d2bf8b1: