Lineage for d2bf8a_ (2bf8 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021591Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1021592Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1021860Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 1021861Protein automated matches [190120] (3 species)
    not a true protein
  7. 1021862Species Cow (Bos taurus) [TaxId:9913] [186972] (1 PDB entry)
  8. 1021863Domain d2bf8a_: 2bf8 A: [128411]
    Other proteins in same PDB: d2bf8b1
    automated match to d1fxta_

Details for d2bf8a_

PDB Entry: 2bf8 (more details), 2.3 Å

PDB Description: crystal structure of sumo modified ubiquitin conjugating enzyme e2-25k
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2-25 kDa

SCOPe Domain Sequences for d2bf8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bf8a_ d.20.1.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
aniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqleik
ipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaae
pddpqdavvanqykqnpemfkqtarlwahvyaga

SCOPe Domain Coordinates for d2bf8a_:

Click to download the PDB-style file with coordinates for d2bf8a_.
(The format of our PDB-style files is described here.)

Timeline for d2bf8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bf8b1