SCOP 1.75: Domain d2bf8a1: 2bf8 A:2-154

Lineage for d2bf8a1 (2bf8 A:2-154)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (4 families)

5. Family d.20.1.1: UBC-related [54496] (6 proteins)

6. Protein Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain [143063] (2 species)
   ubc1 homologue; also contains the C-terminal UBA domain

7. Species Cow (Bos taurus) [TaxId:9913] [143065] (2 PDB entries)
   Uniprot P61085 1-154

8. Domain d2bf8a1: 2bf8 A:2-154 [128411]
   Other proteins in same PDB: d2bf8b1
   automatically matched to 2BEP A:1-154

Details for d2bf8a1

PDB Entry: 2bf8, 2.3 Å

PDB Description: crystal structure of sumo modified ubiquitin conjugating enzyme e2-25k

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2-25 kDa

SCOP Domain Sequences for d2bf8a1:

Sequence; same for both SEQRES and ATOM records:

>d2bf8a1 d.20.1.1 (A:2-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]}
aniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqleik
ipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaae
pddpqdavvanqykqnpemfkqtarlwahvyag

Timeline for d2bf8a1:

• d2bf8a1 first appeared in SCOP 1.73
  
• d2bf8a1 is called d2bf8a_ in SCOPe 2.01
  
• d2bf8a1 appears in the current release, SCOPe 2.08, called d2bf8a_