SCOPe 2.08: Domain d2bf5b_: 2bf5 B:

Lineage for d2bf5b_ (2bf5 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
   corner-like structure formed by two sheets and filled in with 2-3 helices

4. Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family)
   duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold

5. Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
   note: the solution structure determinations disagree in the relative orientations of two motifs

6. Protein automated matches [190214] (3 species)
   not a true protein

7. Species Pseudomonas mendocina [TaxId:300] [186971] (2 PDB entries)

8. Domain d2bf5b_: 2bf5 B: [128406]
   automated match to d1g10a_

Details for d2bf5b_

PDB Entry: 2bf5, 1.71 Å

PDB Description: crystal structure of a toluene 4-monooxygenase catalytic effector protein variant missing four n-terminal residues (delta-n4 t4mod)

PDB Compounds: (B:) toluene-4-monooxygenase system protein d

SCOPe Domain Sequences for d2bf5b_:

Sequence; same for both SEQRES and ATOM records:

>d2bf5b_ d.137.1.1 (B:) automated matches {Pseudomonas mendocina [TaxId: 300]}
nnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltrktleeqlgrp
fnmqeleinlasfagqiqadedqirfyfdktm

Timeline for d2bf5b_:

• d2bf5b_ first appeared in SCOP 1.73, called d2bf5b1
  
• d2bf5b_ appears in SCOPe 2.07