Lineage for d2bf5a1 (2bf5 A:11-102)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734141Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
    corner-like structure formed by two sheets and filled in with 2-3 helices
  4. 734142Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) (S)
    duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold
  5. 734143Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (3 proteins)
    note: the solution structure determinations disagree in the relative orientations of two motifs
  6. 734152Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species)
  7. 734153Species Pseudomonas mendocina [TaxId:300] [64395] (4 PDB entries)
  8. 734154Domain d2bf5a1: 2bf5 A:11-102 [128405]
    automatically matched to d1g10a_

Details for d2bf5a1

PDB Entry: 2bf5 (more details), 1.71 Å

PDB Description: crystal structure of a toluene 4-monooxygenase catalytic effector protein variant missing four n-terminal residues (delta-n4 t4mod)
PDB Compounds: (A:) toluene-4-monooxygenase system protein d

SCOP Domain Sequences for d2bf5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bf5a1 d.137.1.1 (A:11-102) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]}
nnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltrktleeqlgrp
fnmqeleinlasfagqiqadedqirfyfdktm

SCOP Domain Coordinates for d2bf5a1:

Click to download the PDB-style file with coordinates for d2bf5a1.
(The format of our PDB-style files is described here.)

Timeline for d2bf5a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bf5b1