![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily) corner-like structure formed by two sheets and filled in with 2-3 helices |
![]() | Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) ![]() duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold |
![]() | Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins) note: the solution structure determinations disagree in the relative orientations of two motifs |
![]() | Protein automated matches [190214] (3 species) not a true protein |
![]() | Species Pseudomonas mendocina [TaxId:300] [186971] (2 PDB entries) |
![]() | Domain d2bf5a_: 2bf5 A: [128405] automated match to d1g10a_ |
PDB Entry: 2bf5 (more details), 1.71 Å
SCOPe Domain Sequences for d2bf5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bf5a_ d.137.1.1 (A:) automated matches {Pseudomonas mendocina [TaxId: 300]} nnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltrktleeqlgrp fnmqeleinlasfagqiqadedqirfyfdktm
Timeline for d2bf5a_: