SCOP 1.73: Domain d2bf2a1: 2bf2 A:1-102

Lineage for d2bf2a1 (2bf2 A:1-102)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
   corner-like structure formed by two sheets and filled in with 2-3 helices

4. Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family)
   duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold

5. Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (3 proteins)
   note: the solution structure determinations disagree in the relative orientations of two motifs

6. Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species)

7. Species Pseudomonas mendocina [TaxId:300] [64395] (4 PDB entries)

8. Domain d2bf2a1: 2bf2 A:1-102 [128403]
   automatically matched to d1g10a_

Details for d2bf2a1

PDB Entry: 2bf2, 2.1 Å

PDB Description: crystal structure of native toluene-4-monooxygenase catalytic effector protein, t4mod

PDB Compounds: (A:) toluene-4-monooxygenase system protein d

SCOP Domain Sequences for d2bf2a1:

Sequence; same for both SEQRES and ATOM records:

>d2bf2a1 d.137.1.1 (A:1-102) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]}
stladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltr
ktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm

Timeline for d2bf2a1:

• d2bf2a1 is new in SCOP 1.73
  
• d2bf2a1 appears in SCOP 1.75
  
• d2bf2a1 appears in the current release, SCOPe 2.08, called d2bf2a_