![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) ![]() |
![]() | Family a.118.9.4: RNA Polymerase II carboxy-terminal domain (CTD)-interacting (CID) domain (RPR domain) [109975] (4 proteins) found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain SMART 00582; Pfam PF04818 |
![]() | Protein automated matches [190213] (2 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186970] (1 PDB entry) |
![]() | Domain d2bf0x_: 2bf0 X: [128402] automated match to d1szaa_ complexed with ca |
PDB Entry: 2bf0 (more details), 2.3 Å
SCOPe Domain Sequences for d2bf0x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bf0x_ a.118.9.4 (X:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqklyafyal dsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtglplfegsa lekieqflika
Timeline for d2bf0x_: