SCOPe 2.01: Domain d2bf0x_: 2bf0 X:

Lineage for d2bf0x_ (2bf0 X:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.4: RPR domain (SMART 00582 ) [109975] (2 proteins)
   found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain

6. Protein automated matches [190213] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186970] (1 PDB entry)

8. Domain d2bf0x_: 2bf0 X: [128402]
   automated match to d1szaa_
   complexed with ca

Details for d2bf0x_

PDB Entry: 2bf0, 2.3 Å

PDB Description: crystal structure of the rpr of pcf11

PDB Compounds: (X:) pcf11

SCOPe Domain Sequences for d2bf0x_:

Sequence; same for both SEQRES and ATOM records:

>d2bf0x_ a.118.9.4 (X:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqklyafyal
dsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtglplfegsa
lekieqflika

Timeline for d2bf0x_:

• d2bf0x_ first appeared in SCOP 1.73, called d2bf0x1
  
• d2bf0x_ was called d2bf0x1 in SCOP 1.75
  
• d2bf0x_ appears in SCOPe 2.02
  
• d2bf0x_ appears in the current release, SCOPe 2.08