SCOP 1.73: Domain d2bf0x1: 2bf0 X:8-138

Lineage for d2bf0x1 (2bf0 X:8-138)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (4 families)

5. Family a.118.9.4: RPR domain (SMART 00582 ) [109975] (1 protein)
   found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain

6. Protein PCF11 protein [109976] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109977] (3 PDB entries)

8. Domain d2bf0x1: 2bf0 X:8-138 [128402]
   automatically matched to d1szaa_
   complexed with ca

Details for d2bf0x1

PDB Entry: 2bf0, 2.3 Å

PDB Description: crystal structure of the rpr of pcf11

PDB Compounds: (X:) pcf11

SCOP Domain Sequences for d2bf0x1:

Sequence; same for both SEQRES and ATOM records:

>d2bf0x1 a.118.9.4 (X:8-138) PCF11 protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqklyafyal
dsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtglplfegsa
lekieqflika

Timeline for d2bf0x1:

• d2bf0x1 is new in SCOP 1.73
  
• d2bf0x1 appears in SCOP 1.75
  
• d2bf0x1 appears in the current release, SCOPe 2.08, called d2bf0x_