SCOPe 2.05: Domain d2bexd_: 2bex D:

Lineage for d2bexd_ (2bex D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64206] (11 PDB entries)

8. Domain d2bexd_: 2bex D: [128401]
   Other proteins in same PDB: d2bexa_, d2bexb_
   automated match to d1gqva_
   protein/RNA complex; complexed with gol, mak

Details for d2bexd_

PDB Entry: 2bex, 1.99 Å

PDB Description: crystal structure of placental ribonuclease inhibitor in complex with human eosinophil derived neurotoxin at 2a resolution

PDB Compounds: (D:) nonsecretory ribonuclease

SCOPe Domain Sequences for d2bexd_:

Sequence; same for both SEQRES and ATOM records:

>d2bexd_ d.5.1.1 (D:) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens) [TaxId: 9606]}
mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
ppqypvvpvhldrii

Timeline for d2bexd_:

• d2bexd_ first appeared in SCOP 1.73, called d2bexd1
  
• d2bexd_ appears in SCOPe 2.04
  
• d2bexd_ is called d2bexd2 in SCOPe 2.06
  
• d2bexd_ appears in the current release, SCOPe 2.08, called d2bexd2