Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64206] (11 PDB entries) |
Domain d2bexd2: 2bex D:1-134 [128401] Other proteins in same PDB: d2bexa_, d2bexb_, d2bexc3, d2bexd3 automated match to d1gqva_ protein/RNA complex; complexed with gol, mak |
PDB Entry: 2bex (more details), 1.99 Å
SCOPe Domain Sequences for d2bexd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bexd2 d.5.1.1 (D:1-134) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens) [TaxId: 9606]} kppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpnm tcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrdp pqypvvpvhldrii
Timeline for d2bexd2:
View in 3D Domains from other chains: (mouse over for more information) d2bexa_, d2bexb_, d2bexc2, d2bexc3 |