Lineage for d2bexd2 (2bex D:1-134)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928121Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species)
  7. 2928122Species Human (Homo sapiens) [TaxId:9606] [64206] (11 PDB entries)
  8. 2928131Domain d2bexd2: 2bex D:1-134 [128401]
    Other proteins in same PDB: d2bexa_, d2bexb_, d2bexc3, d2bexd3
    automated match to d1gqva_
    protein/RNA complex; complexed with gol, mak

Details for d2bexd2

PDB Entry: 2bex (more details), 1.99 Å

PDB Description: crystal structure of placental ribonuclease inhibitor in complex with human eosinophil derived neurotoxin at 2a resolution
PDB Compounds: (D:) nonsecretory ribonuclease

SCOPe Domain Sequences for d2bexd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bexd2 d.5.1.1 (D:1-134) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens) [TaxId: 9606]}
kppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpnm
tcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrdp
pqypvvpvhldrii

SCOPe Domain Coordinates for d2bexd2:

Click to download the PDB-style file with coordinates for d2bexd2.
(The format of our PDB-style files is described here.)

Timeline for d2bexd2: