Lineage for d2bexc_ (2bex C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890050Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1890051Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1890052Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1890136Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species)
  7. 1890137Species Human (Homo sapiens) [TaxId:9606] [64206] (11 PDB entries)
  8. 1890148Domain d2bexc_: 2bex C: [128400]
    Other proteins in same PDB: d2bexa_, d2bexb_
    automated match to d1gqva_
    protein/RNA complex; complexed with gol, mak

Details for d2bexc_

PDB Entry: 2bex (more details), 1.99 Å

PDB Description: crystal structure of placental ribonuclease inhibitor in complex with human eosinophil derived neurotoxin at 2a resolution
PDB Compounds: (C:) nonsecretory ribonuclease

SCOPe Domain Sequences for d2bexc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bexc_ d.5.1.1 (C:) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens) [TaxId: 9606]}
mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
ppqypvvpvhldrii

SCOPe Domain Coordinates for d2bexc_:

Click to download the PDB-style file with coordinates for d2bexc_.
(The format of our PDB-style files is described here.)

Timeline for d2bexc_: