SCOPe 2.08: Domain d2bexc2: 2bex C:1-134

Lineage for d2bexc2 (2bex C:1-134)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64206] (11 PDB entries)

8. Domain d2bexc2: 2bex C:1-134 [128400]
   Other proteins in same PDB: d2bexa_, d2bexb_, d2bexc3, d2bexd3
   automated match to d1gqva_
   protein/RNA complex; complexed with gol, mak

Details for d2bexc2

PDB Entry: 2bex, 1.99 Å

PDB Description: crystal structure of placental ribonuclease inhibitor in complex with human eosinophil derived neurotoxin at 2a resolution

PDB Compounds: (C:) nonsecretory ribonuclease

SCOPe Domain Sequences for d2bexc2:

Sequence; same for both SEQRES and ATOM records:

>d2bexc2 d.5.1.1 (C:1-134) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens) [TaxId: 9606]}
kppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpnm
tcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrdp
pqypvvpvhldrii

Timeline for d2bexc2:

• d2bexc2 first appeared in SCOP 1.73, called d2bexc1
  
• d2bexc2 appears in SCOPe 2.07