Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.1: RNI-like [52047] (4 families) regular structure consisting of similar repeats |
Family c.10.1.1: 28-residue LRR [52048] (3 proteins) this is a repeat family; one repeat unit is 1a4y A:207-235 found in domain |
Protein automated matches [190173] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186902] (3 PDB entries) |
Domain d2bexa_: 2bex A: [128398] Other proteins in same PDB: d2bexc_, d2bexd_ automated match to d1a4ya_ protein/RNA complex; complexed with gol, mak |
PDB Entry: 2bex (more details), 1.99 Å
SCOPe Domain Sequences for d2bexa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bexa_ c.10.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qsldiqceelsdarwaellpllqqcqvvrlddcgltearckdissalrvnpalaelnlrs nelgdvgvhcvlqglqtpsckiqklslqnccltgagcgvlsstlrtlptlqelhlsdnll gdaglqllceglldpqcrleklqleycslsaasceplasvlrakpdfkeltvsnndinea gvrvlcqglkdspcqlealklescgvtsdncrdlcgivaskaslrelalgsnklgdvgma elcpgllhpssrlrtlwiwecgitakgcgdlcrvlrakeslkelslagnelgdegarllc etllepgcqleslwvkscsftaaccshfssvlaqnrfllelqisnnrledagvrelcqgl gqpgsvlrvlwladcdvsdsscsslaatllanhslreldlsnnclgdagilqlvesvrqp gclleqlvlydiywseemedrlqalekdkpslrvis
Timeline for d2bexa_: