Lineage for d2bevb2 (2bev B:205-342)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 700279Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 700280Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 700322Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins)
  6. 700330Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)
  7. 700331Species Human (Homo sapiens) [TaxId:9606] [52928] (21 PDB entries)
  8. 700338Domain d2bevb2: 2bev B:205-342 [128394]
    Other proteins in same PDB: d2beva1, d2bevb1
    automatically matched to d1dtwb2
    complexed with cl, gol, k, mn, thy

Details for d2bevb2

PDB Entry: 2bev (more details), 1.8 Å

PDB Description: reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
PDB Compounds: (B:) 2-oxoisovalerate dehydrogenase beta subunit

SCOP Domain Sequences for d2bevb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bevb2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt
icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf
yipdkwkcydalrkminy

SCOP Domain Coordinates for d2bevb2:

Click to download the PDB-style file with coordinates for d2bevb2.
(The format of our PDB-style files is described here.)

Timeline for d2bevb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bevb1
View in 3D
Domains from other chains:
(mouse over for more information)
d2beva1