Lineage for d2bevb1 (2bev B:2-204)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592643Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1592644Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1592815Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
    automatically mapped to Pfam PF02779
  6. 1592819Protein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species)
  7. 1592820Species Human (Homo sapiens) [TaxId:9606] [88743] (23 PDB entries)
    Uniprot P21953 52-392
  8. 1592829Domain d2bevb1: 2bev B:2-204 [128393]
    Other proteins in same PDB: d2beva_, d2bevb2
    automated match to d1v16b1
    complexed with cl, gol, k, mn, thy

Details for d2bevb1

PDB Entry: 2bev (more details), 1.8 Å

PDB Description: reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
PDB Compounds: (B:) 2-oxoisovalerate dehydrogenase beta subunit

SCOPe Domain Sequences for d2bevb1:

Sequence, based on SEQRES records: (download)

>d2bevb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
ahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglr
dkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrs
gdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscied
knpciffepkilyraaaeevpie

Sequence, based on observed residues (ATOM records): (download)

>d2bevb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
ahftfqpeygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygk
drvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfn
cgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpci
ffepkilyraaaeevpie

SCOPe Domain Coordinates for d2bevb1:

Click to download the PDB-style file with coordinates for d2bevb1.
(The format of our PDB-style files is described here.)

Timeline for d2bevb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bevb2
View in 3D
Domains from other chains:
(mouse over for more information)
d2beva_