Lineage for d2bera3 (2ber A:47-404)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 807193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 807194Superfamily b.68.1: Sialidases [50939] (2 families) (S)
  5. 807195Family b.68.1.1: Sialidases (neuraminidases) [50940] (9 proteins)
  6. 807297Protein Micromonospora sialidase, N-terminal domain [50946] (1 species)
  7. 807298Species Micromonospora viridifaciens [TaxId:1881] [50947] (8 PDB entries)
    Uniprot Q02834 47-647
  8. 807300Domain d2bera3: 2ber A:47-404 [128388]
    Other proteins in same PDB: d2bera1, d2bera2
    automatically matched to d1eur__
    complexed with na, slb; mutant

Details for d2bera3

PDB Entry: 2ber (more details), 1.8 Å

PDB Description: y370g active site mutant of the sialidase from micromonospora viridifaciens in complex with beta-neu5ac (sialic acid).
PDB Compounds: (A:) bacterial sialidase

SCOP Domain Sequences for d2bera3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bera3 b.68.1.1 (A:47-404) Micromonospora sialidase, N-terminal domain {Micromonospora viridifaciens [TaxId: 1881]}
geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv
avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
irmscddgqtwpvskvfqpgsmsgstltalpdgtygllyepgtgiryanfnlawlggi

SCOP Domain Coordinates for d2bera3:

Click to download the PDB-style file with coordinates for d2bera3.
(The format of our PDB-style files is described here.)

Timeline for d2bera3: