Class b: All beta proteins [48724] (177 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (37 species) not a true protein |
Species Micromonospora viridifaciens [TaxId:1881] [254943] (4 PDB entries) |
Domain d2bera2: 2ber A:506-647 [128387] Other proteins in same PDB: d2bera1, d2bera3 automated match to d1w8oa2 complexed with na, slb; mutant |
PDB Entry: 2ber (more details), 1.8 Å
SCOPe Domain Sequences for d2bera2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bera2 b.18.1.0 (A:506-647) automated matches {Micromonospora viridifaciens [TaxId: 1881]} qarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphrisldlggthtis glqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqravfpardaryirlv alseqtghkyaavaelevegqr
Timeline for d2bera2: