![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (23 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Sialidase, "linker" domain [49237] (1 species) follows the catalytic six-bladed beta-propeller domain |
![]() | Species Micromonospora viridifaciens [TaxId:1881] [49238] (6 PDB entries) Uniprot Q02834 47-647 |
![]() | Domain d2bera1: 2ber A:405-505 [128386] Other proteins in same PDB: d2bera2, d2bera3 automatically matched to d1eut_1 complexed with na, slb; mutant |
PDB Entry: 2ber (more details), 1.8 Å
SCOP Domain Sequences for d2bera1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bera1 b.1.18.2 (A:405-505) Sialidase, "linker" domain {Micromonospora viridifaciens [TaxId: 1881]} capftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqak gqvtitvpagttpgryrvgatlrtsagnasttftvtvglld
Timeline for d2bera1: