Lineage for d2bepa1 (2bep A:1-154)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898314Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1898491Protein Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain [143063] (2 species)
    ubc1 homologue; also contains the C-terminal UBA domain
  7. 1898492Species Cow (Bos taurus) [TaxId:9913] [143065] (1 PDB entry)
    Uniprot P61085 1-154
  8. 1898493Domain d2bepa1: 2bep A:1-154 [128385]
    complexed with bme

Details for d2bepa1

PDB Entry: 2bep (more details), 1.8 Å

PDB Description: crystal structure of ubiquitin conjugating enzyme e2-25k
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2-25 kDa

SCOPe Domain Sequences for d2bepa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]}
maniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqlei
kipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaa
epddpqdavvanqykqnpemfkqtarlwahvyag

SCOPe Domain Coordinates for d2bepa1:

Click to download the PDB-style file with coordinates for d2bepa1.
(The format of our PDB-style files is described here.)

Timeline for d2bepa1: