Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain [143063] (2 species) ubc1 homologue; also contains the C-terminal UBA domain |
Species Cow (Bos taurus) [TaxId:9913] [143065] (1 PDB entry) Uniprot P61085 1-154 |
Domain d2bepa1: 2bep A:1-154 [128385] complexed with bme |
PDB Entry: 2bep (more details), 1.8 Å
SCOPe Domain Sequences for d2bepa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} maniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqlei kipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaa epddpqdavvanqykqnpemfkqtarlwahvyag
Timeline for d2bepa1: