SCOPe 2.04: Domain d2beob2: 2beo B:2-137

Lineage for d2beob2 (2beo B:2-137)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.3: Listeriolysin regulatory protein PrfA, N-terminal domain [89419] (2 proteins)

6. Protein automated matches [254485] (1 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:169963] [255049] (2 PDB entries)

8. Domain d2beob2: 2beo B:2-137 [128384]
   Other proteins in same PDB: d2beoa1, d2beob1
   automated match to d1omia1
   complexed with acm, cl, gln, pg4

Details for d2beob2

PDB Entry: 2beo, 2.7 Å

PDB Description: prfa, transcriptional regulator in listeria monocytogenes

PDB Compounds: (B:) listeriolysin regulatory protein

SCOPe Domain Sequences for d2beob2:

Sequence; same for both SEQRES and ATOM records:

>d2beob2 b.82.3.3 (B:2-137) automated matches {Listeria monocytogenes [TaxId: 169963]}
naqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlq
yykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlq
kqvsyslakfndfsin

Timeline for d2beob2:

• d2beob2 first appeared in SCOP 1.73
  
• d2beob2 appears in SCOPe 2.03
  
• d2beob2 appears in SCOPe 2.05
  
• d2beob2 appears in the current release, SCOPe 2.08