![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.3: Listeriolysin regulatory protein PrfA, N-terminal domain [89419] (2 proteins) |
![]() | Protein automated matches [254485] (1 species) not a true protein |
![]() | Species Listeria monocytogenes [TaxId:169963] [255049] (2 PDB entries) |
![]() | Domain d2beob2: 2beo B:2-137 [128384] Other proteins in same PDB: d2beoa1, d2beob1 automated match to d1omia1 complexed with acm, cl, gln, pg4 |
PDB Entry: 2beo (more details), 2.7 Å
SCOPe Domain Sequences for d2beob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2beob2 b.82.3.3 (B:2-137) automated matches {Listeria monocytogenes [TaxId: 169963]} naqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlq yykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlq kqvsyslakfndfsin
Timeline for d2beob2: