SCOPe 2.03: Domain d2beob2: 2beo B:7-137

Lineage for d2beob2 (2beo B:7-137)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.3: Listeriolysin regulatory protein PrfA, N-terminal domain [89419] (1 protein)

6. Protein Listeriolysin regulatory protein PrfA, N-terminal domain [89420] (1 species)

7. Species Listeria monocytogenes [TaxId:1639] [89421] (3 PDB entries)

8. Domain d2beob2: 2beo B:7-137 [128384]
   Other proteins in same PDB: d2beoa1, d2beob1
   automatically matched to d1omia1
   complexed with acm, cl, gln, pg4

Details for d2beob2

PDB Entry: 2beo, 2.7 Å

PDB Description: prfa, transcriptional regulator in listeria monocytogenes

PDB Compounds: (B:) listeriolysin regulatory protein

SCOPe Domain Sequences for d2beob2:

Sequence; same for both SEQRES and ATOM records:

>d2beob2 b.82.3.3 (B:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Listeria monocytogenes [TaxId: 1639]}
efkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlqyykga
fvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlqkqvsy
slakfndfsin

Timeline for d2beob2:

• d2beob2 first appeared in SCOP 1.73
  
• d2beob2 appears in SCOPe 2.02
  
• d2beob2 appears in SCOPe 2.04
  
• d2beob2 appears in the current release, SCOPe 2.08