Lineage for d2beob2 (2beo B:7-137)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677861Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) (S)
  5. 677954Family b.82.3.3: Listeriolysin regulatory protein PrfA, N-terminal domain [89419] (1 protein)
  6. 677955Protein Listeriolysin regulatory protein PrfA, N-terminal domain [89420] (1 species)
  7. 677956Species Bacteria (Listeria monocytogenes) [TaxId:1639] [89421] (3 PDB entries)
  8. 677966Domain d2beob2: 2beo B:7-137 [128384]
    Other proteins in same PDB: d2beoa1, d2beob1
    automatically matched to d1omia1
    complexed with acm, cl, gln, pg4

Details for d2beob2

PDB Entry: 2beo (more details), 2.7 Å

PDB Description: prfa, transcriptional regulator in listeria monocytogenes
PDB Compounds: (B:) listeriolysin regulatory protein

SCOP Domain Sequences for d2beob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2beob2 b.82.3.3 (B:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]}
efkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlqyykga
fvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlqkqvsy
slakfndfsin

SCOP Domain Coordinates for d2beob2:

Click to download the PDB-style file with coordinates for d2beob2.
(The format of our PDB-style files is described here.)

Timeline for d2beob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2beob1