![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.3: Listeriolysin regulatory protein PrfA, N-terminal domain [89419] (1 protein) |
![]() | Protein Listeriolysin regulatory protein PrfA, N-terminal domain [89420] (1 species) |
![]() | Species Listeria monocytogenes [TaxId:1639] [89421] (3 PDB entries) |
![]() | Domain d2beoa2: 2beo A:7-137 [128382] Other proteins in same PDB: d2beoa1, d2beob1 automatically matched to d1omia1 complexed with acm, cl, gln, pg4 |
PDB Entry: 2beo (more details), 2.7 Å
SCOPe Domain Sequences for d2beoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2beoa2 b.82.3.3 (A:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Listeria monocytogenes [TaxId: 1639]} efkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlqyykga fvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlqkqvsy slakfndfsin
Timeline for d2beoa2: