Lineage for d2beoa2 (2beo A:2-137)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2816658Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2816885Family b.82.3.3: Listeriolysin regulatory protein PrfA, N-terminal domain [89419] (2 proteins)
  6. 2816890Protein automated matches [254485] (1 species)
    not a true protein
  7. 2816891Species Listeria monocytogenes [TaxId:169963] [255049] (2 PDB entries)
  8. 2816900Domain d2beoa2: 2beo A:2-137 [128382]
    Other proteins in same PDB: d2beoa1, d2beob1
    automated match to d1omia1
    complexed with acm, cl, gln, pg4

Details for d2beoa2

PDB Entry: 2beo (more details), 2.7 Å

PDB Description: prfa, transcriptional regulator in listeria monocytogenes
PDB Compounds: (A:) listeriolysin regulatory protein

SCOPe Domain Sequences for d2beoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2beoa2 b.82.3.3 (A:2-137) automated matches {Listeria monocytogenes [TaxId: 169963]}
naqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlq
yykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlq
kqvsyslakfndfsin

SCOPe Domain Coordinates for d2beoa2:

Click to download the PDB-style file with coordinates for d2beoa2.
(The format of our PDB-style files is described here.)

Timeline for d2beoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2beoa1