SCOPe 2.06: Domain d2beoa1: 2beo A:138-237

Lineage for d2beoa1 (2beo A:138-237)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)

6. Protein automated matches [254486] (1 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:169963] [255050] (2 PDB entries)

8. Domain d2beoa1: 2beo A:138-237 [128381]
   Other proteins in same PDB: d2beoa2, d2beob2
   automated match to d2beoa1
   complexed with acm, cl, gln, pg4

Details for d2beoa1

PDB Entry: 2beo, 2.7 Å

PDB Description: prfa, transcriptional regulator in listeria monocytogenes

PDB Compounds: (A:) listeriolysin regulatory protein

SCOPe Domain Sequences for d2beoa1:

Sequence, based on SEQRES records:

>d2beoa1 a.4.5.4 (A:138-237) automated matches {Listeria monocytogenes [TaxId: 169963]}
gklgsicgqlliltyvygketpdgikitldnltmqelgyssgiahssavsriisklkqek
vivyknscfyvqnldylkryapkldewfylacpatwgkln

Sequence, based on observed residues (ATOM records):

>d2beoa1 a.4.5.4 (A:138-237) automated matches {Listeria monocytogenes [TaxId: 169963]}
gklgsicgqlliltyvygketpdgikitldnltmqelavsriisklkqekvivyknscfy
vqnldylkryapkldewfylacpatwgkln

Timeline for d2beoa1:

• d2beoa1 first appeared in SCOP 1.73
  
• d2beoa1 appears in SCOPe 2.05
  
• d2beoa1 appears in SCOPe 2.07
  
• d2beoa1 appears in the current release, SCOPe 2.08