Lineage for d2behi1 (2beh I:4-431)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 742019Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 742020Superfamily e.1.1: Serpins [56574] (1 family) (S)
  5. 742021Family e.1.1.1: Serpins [56575] (16 proteins)
  6. 742032Protein Antithrombin [56584] (2 species)
  7. 742036Species Human (Homo sapiens) [TaxId:9606] [56586] (22 PDB entries)
  8. 742051Domain d2behi1: 2beh I:4-431 [128377]
    automatically matched to d1tb6i_
    complexed with gol, man, nag, ndg; mutant

Details for d2behi1

PDB Entry: 2beh (more details), 2.7 Å

PDB Description: crystal structure of antithrombin variant s137a/v317c/t401c with plasma latent antithrombin
PDB Compounds: (I:) antithrombin-III

SCOP Domain Sequences for d2behi1:

Sequence, based on SEQRES records: (download)

>d2behi1 e.1.1.1 (I:4-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]}
pvdictakprdipmnpmciyrspekkatedegseqkipeatnrrvwelskansrfattfy
qhladskndndniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfff
aklncrlyrkankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsr
aainkwvsnktegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykad
gescsasmmyqegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpev
lqewldeleemmlcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrddly
vsdafhkaflevneegseaaastavviagrslnpnrvcfkanrpflvfirevplntiifm
grvanpcv

Sequence, based on observed residues (ATOM records): (download)

>d2behi1 e.1.1.1 (I:4-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]}
pvdictakprdipmnpmciyrspekkpeatnrrvwelskansrfattfyqhladskndnd
niflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfffaklncrlyrka
nkasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsraainkwvsnkt
egritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykadgescsasmmyq
egkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpevlqewldeleem
mlcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivadlyvsdafhkaflevnee
gseaaastavviagrslnpnrvcfkanrpflvfirevplntiifmgrvanpcv

SCOP Domain Coordinates for d2behi1:

Click to download the PDB-style file with coordinates for d2behi1.
(The format of our PDB-style files is described here.)

Timeline for d2behi1: