Lineage for d2beda_ (2bed A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2010398Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2010399Family a.118.6.1: Protein prenylyltransferase [48440] (3 proteins)
  6. 2010400Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 2010415Species Norway rat (Rattus norvegicus) [TaxId:10116] [48442] (51 PDB entries)
    Uniprot Q04631 55-369
  8. 2010489Domain d2beda_: 2bed A: [128375]
    Other proteins in same PDB: d2bedb_
    automated match to d1o1ra_
    complexed with 736, fpp, zn

Details for d2beda_

PDB Entry: 2bed (more details), 2.7 Å

PDB Description: structure of fpt bound to inhibitor sch207736
PDB Compounds: (A:) Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit

SCOPe Domain Sequences for d2beda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2beda_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gflsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrders
erafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrr
vlvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrn
nsvwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsryp
nllnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirk
eywryigrslqsk

SCOPe Domain Coordinates for d2beda_:

Click to download the PDB-style file with coordinates for d2beda_.
(The format of our PDB-style files is described here.)

Timeline for d2beda_: