Lineage for d2beda1 (2bed A:54-366)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647144Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 647145Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 647146Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 647193Species Rat (Rattus norvegicus) [TaxId:10116] [48442] (27 PDB entries)
  8. 647236Domain d2beda1: 2bed A:54-366 [128375]
    Other proteins in same PDB: d2bedb1
    automatically matched to d1o1ra_
    complexed with 736, fpp, zn

Details for d2beda1

PDB Entry: 2bed (more details), 2.7 Å

PDB Description: structure of fpt bound to inhibitor sch207736
PDB Compounds: (A:) Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit

SCOP Domain Sequences for d2beda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2beda1 a.118.6.1 (A:54-366) Protein farnesyltransferase alpha-subunit {Rat (Rattus norvegicus) [TaxId: 10116]}
gflsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrders
erafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrr
vlvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrn
nsvwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsryp
nllnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirk
eywryigrslqsk

SCOP Domain Coordinates for d2beda1:

Click to download the PDB-style file with coordinates for d2beda1.
(The format of our PDB-style files is described here.)

Timeline for d2beda1: