Lineage for d2be9b2 (2be9 B:105-160)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263404Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 2263405Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 2263406Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 2263543Species Sulfolobus acidocaldarius [TaxId:2285] [111453] (2 PDB entries)
  8. 2263545Domain d2be9b2: 2be9 B:105-160 [128374]
    Other proteins in same PDB: d2be9a1, d2be9a2, d2be9b1
    automated match to d1pg5b2
    complexed with ctp, so4, zn

Details for d2be9b2

PDB Entry: 2be9 (more details), 2.6 Å

PDB Description: Crystal structure of the CTP-liganded (T-State) aspartate transcarbamoylase from the extremely thermophilic archaeon Sulfolobus acidocaldarius
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2be9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2be9b2 g.41.7.1 (B:105-160) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Sulfolobus acidocaldarius [TaxId: 2285]}
kvvkgilkcpnpycitsndveaiptfktltekplkmrceycetiideneimsqilg

SCOPe Domain Coordinates for d2be9b2:

Click to download the PDB-style file with coordinates for d2be9b2.
(The format of our PDB-style files is described here.)

Timeline for d2be9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2be9b1