![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) ![]() automatically mapped to Pfam PF02748 |
![]() | Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein) |
![]() | Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species) |
![]() | Species Sulfolobus acidocaldarius [TaxId:2285] [111453] (2 PDB entries) |
![]() | Domain d2be9b2: 2be9 B:105-160 [128374] Other proteins in same PDB: d2be9a1, d2be9a2, d2be9b1 automated match to d1pg5b2 complexed with ctp, so4, zn |
PDB Entry: 2be9 (more details), 2.6 Å
SCOPe Domain Sequences for d2be9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2be9b2 g.41.7.1 (B:105-160) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Sulfolobus acidocaldarius [TaxId: 2285]} kvvkgilkcpnpycitsndveaiptfktltekplkmrceycetiideneimsqilg
Timeline for d2be9b2: