SCOPe 2.08: Domain d2be9b2: 2be9 B:105-160

Lineage for d2be9b2 (2be9 B:105-160)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families)
   automatically mapped to Pfam PF02748

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)

7. Species Sulfolobus acidocaldarius [TaxId:2285] [111453] (2 PDB entries)

8. Domain d2be9b2: 2be9 B:105-160 [128374]
   Other proteins in same PDB: d2be9a1, d2be9a2, d2be9b1
   automated match to d1pg5b2
   complexed with ctp, so4, zn

Details for d2be9b2

PDB Entry: 2be9, 2.6 Å

PDB Description: Crystal structure of the CTP-liganded (T-State) aspartate transcarbamoylase from the extremely thermophilic archaeon Sulfolobus acidocaldarius

PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2be9b2:

Sequence; same for both SEQRES and ATOM records:

>d2be9b2 g.41.7.1 (B:105-160) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Sulfolobus acidocaldarius [TaxId: 2285]}
kvvkgilkcpnpycitsndveaiptfktltekplkmrceycetiideneimsqilg

Timeline for d2be9b2:

• d2be9b2 first appeared in SCOP 1.73
  
• d2be9b2 appears in SCOPe 2.07