SCOPe 2.05: Domain d2be9b1: 2be9 B:11-104

Lineage for d2be9b1 (2be9 B:11-104)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families)
   automatically mapped to Pfam PF01948

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (3 species)

7. Species Sulfolobus acidocaldarius [TaxId:2285] [110950] (2 PDB entries)

8. Domain d2be9b1: 2be9 B:11-104 [128373]
   Other proteins in same PDB: d2be9a1, d2be9a2, d2be9b2
   automated match to d1pg5b1
   complexed with ctp, so4, zn

Details for d2be9b1

PDB Entry: 2be9, 2.6 Å

PDB Description: Crystal structure of the CTP-liganded (T-State) aspartate transcarbamoylase from the extremely thermophilic archaeon Sulfolobus acidocaldarius

PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2be9b1:

Sequence, based on SEQRES records:

>d2be9b1 d.58.2.1 (B:11-104) Aspartate carbamoyltransferase {Sulfolobus acidocaldarius [TaxId: 2285]}
mvskikngtvidhipagrafavlnvlgikghegfrialvinvdskkmgkkdivkiedkei
sdteanlitliaptatinivreyevvkktklevp

Sequence, based on observed residues (ATOM records):

>d2be9b1 d.58.2.1 (B:11-104) Aspartate carbamoyltransferase {Sulfolobus acidocaldarius [TaxId: 2285]}
mvskikngtvidhipagrafavlnvlgikegfrialvinvdskkmgkkdivkiedkeisd
teanlitliaptatinivreyevvkktklevp

Timeline for d2be9b1:

• d2be9b1 first appeared in SCOP 1.73
  
• d2be9b1 appears in SCOPe 2.04
  
• d2be9b1 appears in SCOPe 2.06
  
• d2be9b1 appears in the current release, SCOPe 2.08