Lineage for d2be9b1 (2be9 B:11-104)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949509Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 2949510Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 2949511Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. 2949653Species Sulfolobus acidocaldarius [TaxId:2285] [110950] (2 PDB entries)
  8. 2949655Domain d2be9b1: 2be9 B:11-104 [128373]
    Other proteins in same PDB: d2be9a1, d2be9a2, d2be9b2
    automated match to d1pg5b1
    complexed with ctp, so4, zn

Details for d2be9b1

PDB Entry: 2be9 (more details), 2.6 Å

PDB Description: Crystal structure of the CTP-liganded (T-State) aspartate transcarbamoylase from the extremely thermophilic archaeon Sulfolobus acidocaldarius
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2be9b1:

Sequence, based on SEQRES records: (download)

>d2be9b1 d.58.2.1 (B:11-104) Aspartate carbamoyltransferase {Sulfolobus acidocaldarius [TaxId: 2285]}
mvskikngtvidhipagrafavlnvlgikghegfrialvinvdskkmgkkdivkiedkei
sdteanlitliaptatinivreyevvkktklevp

Sequence, based on observed residues (ATOM records): (download)

>d2be9b1 d.58.2.1 (B:11-104) Aspartate carbamoyltransferase {Sulfolobus acidocaldarius [TaxId: 2285]}
mvskikngtvidhipagrafavlnvlgikegfrialvinvdskkmgkkdivkiedkeisd
teanlitliaptatinivreyevvkktklevp

SCOPe Domain Coordinates for d2be9b1:

Click to download the PDB-style file with coordinates for d2be9b1.
(The format of our PDB-style files is described here.)

Timeline for d2be9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2be9b2