![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) ![]() |
![]() | Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins) |
![]() | Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species) |
![]() | Species Archaeon Sulfolobus acidocaldarius [TaxId:2285] [110719] (2 PDB entries) |
![]() | Domain d2be9a2: 2be9 A:147-299 [128372] Other proteins in same PDB: d2be9b1, d2be9b2 automatically matched to d1pg5a2 complexed with ctp, so4, zn |
PDB Entry: 2be9 (more details), 2.6 Å
SCOP Domain Sequences for d2be9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2be9a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} idglvfallgdlkyartvnsllriltrfrpklvylispqllrarkeildelnypvkeven pfevinevdvlyvtriqkerfvdemeyekikgsyivsldlankmkkdsiilhplprvnei drkvdkttkakyfeqasygvpvrmsiltkiyge
Timeline for d2be9a2: