Lineage for d2be9a1 (2be9 A:0-146)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139045Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2139046Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2139047Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 protein domains)
  6. 2139048Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2139354Species Sulfolobus acidocaldarius [TaxId:2285] [110719] (2 PDB entries)
    Uniprot Q55338
  8. 2139357Domain d2be9a1: 2be9 A:0-146 [128371]
    Other proteins in same PDB: d2be9b1, d2be9b2
    automated match to d1pg5a1
    complexed with ctp, so4, zn

Details for d2be9a1

PDB Entry: 2be9 (more details), 2.6 Å

PDB Description: Crystal structure of the CTP-liganded (T-State) aspartate transcarbamoylase from the extremely thermophilic archaeon Sulfolobus acidocaldarius
PDB Compounds: (A:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d2be9a1:

Sequence, based on SEQRES records: (download)

>d2be9a1 c.78.1.1 (A:0-146) Aspartate carbamoyltransferase catalytic subunit {Sulfolobus acidocaldarius [TaxId: 2285]}
mlkhiisaynfsrdeledifaltdkysknlndtrkilsgktisiaffepstrtylsfqka
iinlggdvigfsgeestsvakgenladtirmlnnysdgivmrhkydgasrfaseisdipv
inagdgkhehptqavidiytinkhfnt

Sequence, based on observed residues (ATOM records): (download)

>d2be9a1 c.78.1.1 (A:0-146) Aspartate carbamoyltransferase catalytic subunit {Sulfolobus acidocaldarius [TaxId: 2285]}
mlkhiisaynfsrdeledifaltdkysknlndtrkilsgktisiaffepstrtylsfqka
iinlggdvigfsgegenladtirmlnnysdgivmrhkydgasrfaseisdipvinagdgk
hehptqavidiytinkhfnt

SCOPe Domain Coordinates for d2be9a1:

Click to download the PDB-style file with coordinates for d2be9a1.
(The format of our PDB-style files is described here.)

Timeline for d2be9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2be9a2