| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily) multihelical; consists of a conserved 4-helical core and a variable insert subdomain |
Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) ![]() |
| Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins) |
| Protein Sigma70 [88948] (2 species) |
| Species Thermus thermophilus [TaxId:274] [88949] (11 PDB entries) Uniprot Q9WX78 |
| Domain d2be5p3: 2be5 P:74-257 [128370] Other proteins in same PDB: d2be5a1, d2be5a2, d2be5b1, d2be5b2, d2be5c_, d2be5d_, d2be5e_, d2be5f1, d2be5f2, d2be5k1, d2be5k2, d2be5l1, d2be5l2, d2be5m_, d2be5n_, d2be5o_, d2be5p1, d2be5p2 automated match to d1smyf3 protein/RNA complex; complexed with mg, tgt, zn has additional subdomain(s) that are not in the common domain |
PDB Entry: 2be5 (more details), 2.4 Å
SCOPe Domain Sequences for d2be5p3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2be5p3 a.177.1.1 (P:74-257) Sigma70 {Thermus thermophilus [TaxId: 274]}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qart
Timeline for d2be5p3: