| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) ![]() form homo and heterodimers |
| Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins) |
| Protein RNA polymerase alpha [55259] (3 species) |
| Species Thermus thermophilus [TaxId:274] [75478] (9 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
| Domain d2be5l1: 2be5 L:1-49,L:173-229 [128363] Other proteins in same PDB: d2be5a2, d2be5b2, d2be5c1, d2be5d1, d2be5e1, d2be5f1, d2be5f2, d2be5f3, d2be5k2, d2be5l2, d2be5m1, d2be5n1, d2be5o1, d2be5p1, d2be5p2, d2be5p3 automatically matched to d1iw7a1 complexed with mg, tgt, zn |
PDB Entry: 2be5 (more details), 2.4 Å
SCOP Domain Sequences for d2be5l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2be5l1 d.74.3.1 (L:1-49,L:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
Timeline for d2be5l1: