SCOPe 2.08: Domain d2be5b2: 2be5 B:50-172

Lineage for d2be5b2 (2be5 B:50-172)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)
   automatically mapped to Pfam PF01000

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)

6. Protein RNA polymerase alpha subunit [56555] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d2be5b2: 2be5 B:50-172 [128354]
   Other proteins in same PDB: d2be5a1, d2be5b1, d2be5c_, d2be5d_, d2be5e_, d2be5f1, d2be5f2, d2be5f3, d2be5k1, d2be5l1, d2be5m_, d2be5n_, d2be5o_, d2be5p1, d2be5p2, d2be5p3
   automated match to d1smya2
   protein/RNA complex; complexed with mg, tgt, zn

Details for d2be5b2

PDB Entry: 2be5, 2.4 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with inhibitor tagetitoxin

PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2be5b2:

Sequence; same for both SEQRES and ATOM records:

>d2be5b2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

Timeline for d2be5b2:

• d2be5b2 first appeared in SCOP 1.73
  
• d2be5b2 appears in SCOPe 2.07