Lineage for d2be5a1 (2be5 A:1-49,A:173-229)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958148Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2958149Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)
  6. 2958150Protein RNA polymerase alpha [55259] (3 species)
  7. 2958165Species Thermus thermophilus [TaxId:274] [75478] (16 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 2958182Domain d2be5a1: 2be5 A:1-49,A:173-229 [128351]
    Other proteins in same PDB: d2be5a2, d2be5b2, d2be5c_, d2be5d_, d2be5e_, d2be5f1, d2be5f2, d2be5f3, d2be5k2, d2be5l2, d2be5m_, d2be5n_, d2be5o_, d2be5p1, d2be5p2, d2be5p3
    automated match to d1smya1
    protein/RNA complex; complexed with mg, tgt, zn

Details for d2be5a1

PDB Entry: 2be5 (more details), 2.4 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with inhibitor tagetitoxin
PDB Compounds: (A:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2be5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2be5a1 d.74.3.1 (A:1-49,A:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

SCOPe Domain Coordinates for d2be5a1:

Click to download the PDB-style file with coordinates for d2be5a1.
(The format of our PDB-style files is described here.)

Timeline for d2be5a1: