Lineage for d2be3b_ (2be3 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1944794Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1944795Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 1945170Family d.218.1.8: RelA/SpoT domain [102945] (3 proteins)
    Pfam PF04607; ppGpp-synthetase
  6. 1945171Protein Putative GTP pyrophosphokinase SP1097 [143234] (1 species)
  7. 1945172Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143235] (1 PDB entry)
    Uniprot Q97QV1 1-203
  8. 1945174Domain d2be3b_: 2be3 B: [128350]
    automated match to d2be3a1
    complexed with cl, gol, pg4

Details for d2be3b_

PDB Entry: 2be3 (more details), 2.4 Å

PDB Description: structure of a gtp pyrophosphokinase family protein from streptococcus pneumoniae
PDB Compounds: (B:) GTP pyrophosphokinase

SCOPe Domain Sequences for d2be3b_:

Sequence, based on SEQRES records: (download)

>d2be3b_ d.218.1.8 (B:) Putative GTP pyrophosphokinase SP1097 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tleweefldpyiqavgelkiklrgirkqyrkqnkhspiefvtgrvkpiesikekmarrgi
tyatlehdlqdiaglrvmvqfvddvkevvdilhkrqdmriiqerdyithrkasgyrsyhv
vveytvdtingaktilaeiqirtlamnfwatiehslnykyqgdfpdeikkrleitariah
qldeemgeirddiqeaqalf

Sequence, based on observed residues (ATOM records): (download)

>d2be3b_ d.218.1.8 (B:) Putative GTP pyrophosphokinase SP1097 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tleweefldpyiqavgelkiklrgirkqyrkqnkhspiefvtgrvkpiesikekmahdlq
diaglrvmvqfvddvkevvdilhkrqdmriiqerdyithrkasgyrsyhvvveytvdtin
gaktilaeiqirtlamnfwatiehslnykyqdfpdeikkrleitariahqldeemgeird
diqeaqalf

SCOPe Domain Coordinates for d2be3b_:

Click to download the PDB-style file with coordinates for d2be3b_.
(The format of our PDB-style files is described here.)

Timeline for d2be3b_: