Lineage for d2bdta1 (2bdt A:1-176)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871535Family c.37.1.25: Atu3015-like [142332] (2 proteins)
    unknown function; similar to the nucleotide/nucleoside kinases
  6. 2871539Protein Hypothetical protein BH3686 [142333] (1 species)
    annotated as putative gluconate kinase by NESG
  7. 2871540Species Bacillus halodurans [TaxId:86665] [142334] (1 PDB entry)
    Uniprot Q9K6P2 1-176
  8. 2871541Domain d2bdta1: 2bdt A:1-176 [128344]
    complexed with so4

Details for d2bdta1

PDB Entry: 2bdt (more details), 2.4 Å

PDB Description: crystal structure of the putative gluconate kinase from bacillus halodurans, northeast structural genomics target bhr61
PDB Compounds: (A:) bh3686

SCOPe Domain Sequences for d2bdta1:

Sequence, based on SEQRES records: (download)

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}
mkklyiitgpagvgksttckrlaaqldnsayiegdiinhmvvggyrppwesdellaltwk
nitdltvnfllaqndvvldyiafpdeaealaqtvqakvddveirfiilwtnreellrrda
lrkkdeqmgerclelveefeskgideryfyntshlqptnlndivknlktnprfifc

Sequence, based on observed residues (ATOM records): (download)

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}
mkklyiitgpagvgksttckrlaaqldnsayiegdiinhmvvggyrppwesdellaltwk
nitdltvnfllaqndvvldyiafpdeaealaqtvqakvddveirfiilwtnreellrrda
lrkkgerclelveefeskgideryfyntshlqptnlndivknlktnprfifc

SCOPe Domain Coordinates for d2bdta1:

Click to download the PDB-style file with coordinates for d2bdta1.
(The format of our PDB-style files is described here.)

Timeline for d2bdta1: