![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.14: Ureidoglycolate hydrolase AllA [117312] (1 protein) Pfam PF04115; beta-hairpin-swapped dimeric protein of the germin-like fold |
![]() | Protein Ureidoglycolate hydrolase AllA [117313] (4 species) |
![]() | Species Pseudomonas putida [TaxId:160488] [186969] (1 PDB entry) |
![]() | Domain d2bdrb_: 2bdr B: [128343] automated match to d1xsra_ complexed with na |
PDB Entry: 2bdr (more details), 1.6 Å
SCOPe Domain Sequences for d2bdrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bdrb_ b.82.1.14 (B:) Ureidoglycolate hydrolase AllA {Pseudomonas putida [TaxId: 160488]} mrtlmiepltkeafaqfgdvietdgsdhfminngstmrfhklatvetaepedkaiisifr adaqdmpltvrmlerhplgsqafipllgnpflivvapvgdapvsglvrafrsngrqgvny hrgvwhhpvltiekrddflvvdrsgsgnncdehyfteeqmlilnph
Timeline for d2bdrb_: