Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.14: Ureidoglycolate hydrolase AllA [117312] (1 protein) Pfam PF04115; beta-hairpin-swapped dimeric protein of the germin-like fold |
Protein Ureidoglycolate hydrolase AllA [117313] (4 species) |
Species Pseudomonas putida [TaxId:303] [141603] (1 PDB entry) Uniprot P59285 1-166 |
Domain d2bdra1: 2bdr A:1-166 [128342] complexed with na |
PDB Entry: 2bdr (more details), 1.6 Å
SCOPe Domain Sequences for d2bdra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bdra1 b.82.1.14 (A:1-166) Ureidoglycolate hydrolase AllA {Pseudomonas putida [TaxId: 303]} mrtlmiepltkeafaqfgdvietdgsdhfminngstmrfhklatvetaepedkaiisifr adaqdmpltvrmlerhplgsqafipllgnpflivvapvgdapvsglvrafrsngrqgvny hrgvwhhpvltiekrddflvvdrsgsgnncdehyfteeqmlilnph
Timeline for d2bdra1: