Lineage for d2bdma1 (2bdm A:28-492)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646332Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 646333Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 646334Family a.104.1.1: Cytochrome P450 [48265] (21 proteins)
  6. 646552Protein Mammalian cytochrome p450 2b4 [101375] (1 species)
  7. 646553Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [101376] (3 PDB entries)
  8. 646556Domain d2bdma1: 2bdm A:28-492 [128340]
    automatically matched to d1suoa_
    complexed with cm5, hem, tmi

Details for d2bdma1

PDB Entry: 2bdm (more details), 2.3 Å

PDB Description: structure of cytochrome p450 2b4 with bound bifonazole
PDB Compounds: (A:) Cytochrome P450 2B4

SCOP Domain Sequences for d2bdma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bdma1 a.104.1.1 (A:28-492) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gklppgpsplpvlgnllqmdrkgllrsflrlrekygdvftvylgsrpvvvlcgtdairea
lvdqaeafsgrgkiavvdpifqgygvifangerwralrrfslatmrdfgmgkrsveeriq
eearclveelrkskgalldntllfhsitsniicsivfgkrfdykdpvflrlldlffqsfs
lissfssqvfelfsgflkyfpgthrqiyrnlqeintfigqsvekhratldpsnprdfidv
yllrmekdksdpssefhhqnliltvlslffagtettsttlrygfllmlkyphvtervqke
ieqvigshrppalddrakmpytdaviheiqrlgdlipfgvphtvtkdtqfrgyvipknte
vfpvlssalhdpryfetpntfnpghfldangalkrnegfmpfslgkriclgegiartelf
lffttilqnfsiaspvppedidltpresgvgnvppsyqirflarh

SCOP Domain Coordinates for d2bdma1:

Click to download the PDB-style file with coordinates for d2bdma1.
(The format of our PDB-style files is described here.)

Timeline for d2bdma1: